DPCfam | MC411059
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Residues in low-complexity regions (%) | 3.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.57 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17408- PF05292 |
| Sequences matching dominant architecture (%) | 95.56 |
| Average overlap percent | 33.58 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F6IFN6 | 117-180 | 64 | GTQRLIGLREDLLAVPRNTRSAGMAALDRELESAFTAWFNAGFLELRRIAWDSPAFLLERIIRY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A3KP65-F1 | 134-234 | 99.02 | 93.82 | View in AlphaFoldDB ↗ |