DPCfam | MC411031
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 331 ± 54 aa |
| Residues in low-complexity regions (%) | 4.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.58 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G5C572 | 2-486 | 485 | AFQCVLKWLDGPLIKQGALEVLSEVECHLRVSLFDVTYRHFFGRTWKTMVKPTRQLSQQPPRIIFREVPPCTWLLCLLQLPPVPW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O75161-F1 | 53-399 | 99.70 | 75.20 | View in AlphaFoldDB ↗ |