DPCfam | MC411023
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 139 ± 16 aa |
| Residues in low-complexity regions (%) | 4.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.41 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF06920 |
| Sequences matching dominant architecture (%) | 84.42 |
| Average overlap percent | 3.75 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3DJQ3 | 1391-1515 | 125 | TKAELDQEALISGNLATECNLIVLDLLETILQAVPLSECKDNVVGGVLKVLLHSLTCNQSTTFLSHTFSTLRALVIKFGDLLFEE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A044RAA8-F1 | 1463-1594 | 99.26 | 85.62 | View in AlphaFoldDB ↗ |