DPCfam | MC410900
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 152 ± 16 aa |
| Residues in low-complexity regions (%) | 5.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.17 |
| Average transmembrane regions | 0.37 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2TIB9 | 225-391 | 167 | ALFPPEPKVLAEMCQSGYKDALRFLQENTSNITSNTASNLPSNITNNIPSDTTSNITSNLPSSPTSNLLSNPISNITSNPTSNII... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E1JI03-F1 | 224-362 | 98.10 | 68.27 | View in AlphaFoldDB ↗ |