DPCfam | MC410319
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 107 ± 7 aa |
| Residues in low-complexity regions (%) | 2.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.65 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02289 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 41.2 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M0BPK8 | 207-314 | 108 | GYAPIMPVHTDWGMAMGRAEDALTYGGVTGYIVDEDDETLRDLAGRAPSINCKDYGKTSYEIYKAVDFDFTQIDPALFAPAVVSL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P94954-F1 | 208-315 | 99.09 | 97.69 | View in AlphaFoldDB ↗ |