DPCfam | MC410188
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 63 ± 8 aa |
| Residues in low-complexity regions (%) | 1.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.57 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11175 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 22.6 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A151BA39 | 290-347 | 58 | SMYRFHIEDPIYFRKSIRVTIEHGHANDRSDDWSSVAYWYQTEPHYEFTKLPPPELRR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A133CSL9-F1 | 308-369 | 96.88 | 96.76 | View in AlphaFoldDB ↗ |