DPCfam | MC410071
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 75 ± 14 aa |
| Residues in low-complexity regions (%) | 1.33 |
| Residues in coiled-coil regions (%) | 3.19 |
| Predicted disordered residues (%) | 23.02 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02338 |
| Sequences matching dominant architecture (%) | 37.68 |
| Average overlap percent | 6.69 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00084B4C06 | 1064-1129 | 66 | DAAPPAVIPLTTRQHALLPLHFAVDPGEAWTPNADPDPPIEPLSYHRKLHLLKSYLHVVEVPISRD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A044QU84-F1 | 320-406 | 96.67 | 87.26 | View in AlphaFoldDB ↗ |