DPCfam | MC410061
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 190 ± 24 aa |
| Residues in low-complexity regions (%) | 9.15 |
| Residues in coiled-coil regions (%) | 0.51 |
| Predicted disordered residues (%) | 33.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13424 |
| Sequences matching dominant architecture (%) | 1.12 |
| Average overlap percent | 0.67 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E3QU98 | 139-343 | 205 | DIRSLASEPEDIQSQDGSATDHWAVTTAAVSYLAEVLAEDPDLTPLYLDAAQRLEDYRFLGNHRRLLKKYYLYLRSQTTNQKQRA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GN48-F1 | 507-717 | 99.00 | 75.39 | View in AlphaFoldDB ↗ |