DPCfam | MC410000
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 238 ± 28 aa |
| Residues in low-complexity regions (%) | 7.5 |
| Residues in coiled-coil regions (%) | 49.23 |
| Predicted disordered residues (%) | 34.59 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V9E6K5 | 56-310 | 255 | ESADATVDSVRTALLPYLTLMARHQVQLSISPPLQGDVRTQRRLNDALGFDQVLAAVQPLSDTLPDLPHAVGELTAQLKISREEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q980C6-F1 | 250-361 | 44.09 | 96.14 | View in AlphaFoldDB ↗ |