DPCfam | MC409897
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 140 ± 17 aa |
| Residues in low-complexity regions (%) | 7.73 |
| Residues in coiled-coil regions (%) | 0.2 |
| Predicted disordered residues (%) | 26.35 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006C94A12 | 2490-2591 | 102 | DQLDPGVDHEEFFDQIIKNLLYLAKFVEIENTEESEKKMSLHWLIKSLRKKINLEITQAPQSIVVRKAVFHWIAGVTVNIDIEKL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GRL4-F1 | 2372-2506 | 92.20 | 67.20 | View in AlphaFoldDB ↗ |