DPCfam | MC40962
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 262 ± 49 aa |
| Residues in low-complexity regions (%) | 7.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 44.66 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00307- PF15949 |
| Sequences matching dominant architecture (%) | 59.6 |
| Average overlap percent | 82.91 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3AZR0 | 3-201 | 199 | EESYRRLKSVLITLYWLGRRAQSDPLYNGPLLNVKAFEELLGQTLTKALEESGSLKRSGRDSGYGDIWHIERGELLTSPASHRRE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9UPQ0-F1 | 23-312 | 99.34 | 66.10 | View in AlphaFoldDB ↗ |