DPCfam | MC409037
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 109 ± 23 aa |
| Residues in low-complexity regions (%) | 4.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.46 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06980 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 17.82 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B8V164 | 15-115 | 101 | LALAVSLASAGAAHALPFQLENGWEGEWNTTLSVGSQWRAEGQDNDLYSAANGALRGKSGGTGGSVDAGNLNYDKGDRFSTIAKF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HYI3-F1 | 14-122 | 96.46 | 87.58 | View in AlphaFoldDB ↗ |