DPCfam | MC408833
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 225 ± 21 aa |
| Residues in low-complexity regions (%) | 14.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.34 |
| Average transmembrane regions | 5.38 |
| Dominant Pfam architecture(s) | PF09913 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 29.02 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A021W0A7 | 249-485 | 237 | VLLAVVATFAYLSAGQSSALEAPRPQPFTLGAFGDILLDVPDLWVGALGRWGLGWLDTAMPPAVWALSWGVLVAVVFQGLARVTW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EMC6-F1 | 390-522 | 56.14 | 94.35 | View in AlphaFoldDB ↗ |