DPCfam | MC408806
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 240 ± 39 aa |
| Residues in low-complexity regions (%) | 5.73 |
| Residues in coiled-coil regions (%) | 3.59 |
| Predicted disordered residues (%) | 15.64 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF14970 |
| Sequences matching dominant architecture (%) | 90.32 |
| Average overlap percent | 70.91 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A393854 | 28-255 | 228 | FWRLLYALLKQIHGGKWAESDAIDNQIRFVKSTLWYHGYGRPELYRLPSDGSAGSRELLLAFSWLLHRLSLLEQLLARNRVKTGD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3UK37-F1 | 17-258 | 98.00 | 80.12 | View in AlphaFoldDB ↗ |