DPCfam | MC408679
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Residues in low-complexity regions (%) | 0.84 |
| Residues in coiled-coil regions (%) | 5.66 |
| Predicted disordered residues (%) | 18.32 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF17109 |
| Sequences matching dominant architecture (%) | 0.44 |
| Average overlap percent | 73.28 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W2TNF2 | 14-97 | 84 | AIEDAFSSLEQTISPAESRNFANTTLQDVRLAAIQLEQQLAARRCLRNMRRLEPLFNGLEHYTRVVEVVYNGTPYLAWIWAPIT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GZW4-F1 | 13-100 | 97.78 | 86.79 | View in AlphaFoldDB ↗ |