DPCfam | MC407766
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 371 |
|---|---|
| Mean domain length (aa) | 214 ± 16 aa |
| Residues in low-complexity regions (%) | 2.46 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.04 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF09844 |
| Sequences matching dominant architecture (%) | 97.98 |
| Average overlap percent | 92.82 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B9XPP1 | 6-234 | 229 | IQGIIRRRILVNYRVDSVVMQRQLPEKFRPKLHNGFAIGGICLIKLEEIRPKGMPAFLGISSENAAHRVAVLWDDEQGKAQEGVY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P54543-F1 | 18-228 | 99.53 | 92.38 | View in AlphaFoldDB ↗ |