DPCfam | MC407754
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 296 ± 43 aa |
| Residues in low-complexity regions (%) | 5.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.14 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05159 |
| Sequences matching dominant architecture (%) | 2.74 |
| Average overlap percent | 33.36 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I3S8S2 | 123-353 | 231 | RPCLISFLGGLDFFPERGLRHRLVSDAVFVFPRPDIALFKEIRRQSGEAGFWQYVGFGHPAALAPKAPLADLHSRKDIYFFAQAI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P55467-F1 | 268-322 | 18.77 | 96.36 | View in AlphaFoldDB ↗ |