DPCfam | MC407708
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 68 ± 9 aa |
| Residues in low-complexity regions (%) | 6.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02057 |
| Sequences matching dominant architecture (%) | 98.31 |
| Average overlap percent | 22.17 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F0R8Q2 | 31-99 | 69 | QTIRLDGNAGGKRFDGIGVVNGGGATSVLLKDYPEPQRSQILDMVYKPKFGASISALLVEIPGDGNSTQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P54803-F1 | 46-110 | 98.48 | 98.51 | View in AlphaFoldDB ↗ |