DPCfam | MC40723
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 891 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Residues in low-complexity regions (%) | 4.07 |
| Residues in coiled-coil regions (%) | 0.25 |
| Predicted disordered residues (%) | 22.56 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF06812 |
| Sequences matching dominant architecture (%) | 99.53 |
| Average overlap percent | 88.81 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000830AF7D | 2-130 | 129 | NYQQLLSEPLSADAACGQNLEDDAEFQNFFFLAQGTPERFDGENTIAAEPPDWRTVKKTALGYLEQSKDIKLMCVLAQAVLNTEG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I1B9-F1 | 16-138 | 98.29 | 92.88 | View in AlphaFoldDB ↗ |