DPCfam | MC407179
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 381 |
|---|---|
| Mean domain length (aa) | 142 ± 21 aa |
| Residues in low-complexity regions (%) | 2.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.15 |
| Average transmembrane regions | 0.11 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G2QM22 | 171-287 | 117 | RADQFCIYKTSDGAKVPAIAIEYKAPYKLSREELVIGLVSEIQPERDVINKDGDGFAFAAKRLATAIYGYVCTGEAFVFLHIPDD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1H0Q6-F1 | 223-365 | 98.06 | 90.92 | View in AlphaFoldDB ↗ |