DPCfam | MC407127
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 116 ± 13 aa |
| Residues in low-complexity regions (%) | 19.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.19 |
| Average transmembrane regions | 2.06 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1H6DMV8 | 339-443 | 105 | NAFDSIFRPRYVLFCLPALALLVGAGLAWLGGVRRELLAGALAVAVAAALPAHLAIREQGERNDDLRAAADVLREHARPGDAVLF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O06152-F1 | 341-461 | 100.00 | 93.19 | View in AlphaFoldDB ↗ |