DPCfam | MC407122
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 361 |
|---|---|
| Mean domain length (aa) | 1629 ± 273 aa |
| Residues in low-complexity regions (%) | 5.3 |
| Residues in coiled-coil regions (%) | 0.13 |
| Predicted disordered residues (%) | 16.31 |
| Average transmembrane regions | 0.31 |
| Dominant Pfam architecture(s) | PF07539 |
| Sequences matching dominant architecture (%) | 90.57 |
| Average overlap percent | 31.31 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A087HQ79 | 699-2292 | 1594 | NGEACKGEEWKKLLIQWLNLLKLMKNLNSSRLSLFVNDVLKNRFLDDNDAEIQTNVLQCLMLWNDYLLPHRSHLENLIKTEELRE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D8PJ54-F1 | 830-2460 | 100.00 | 79.78 | View in AlphaFoldDB ↗ |