DPCfam | MC407081
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 164 ± 23 aa |
| Residues in low-complexity regions (%) | 3.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.09 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF16157 |
| Sequences matching dominant architecture (%) | 95.83 |
| Average overlap percent | 94.78 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A34962E | 1-178 | 178 | MNAMQYKITLPDDYDMALIRNRVKKNGSKTDNFHDLLFKAYLISEKVQGAISNSYAPLYVWKNADGMNQFIFEGFYDNIINDFGW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2G1Q7-F1 | 1-162 | 96.00 | 95.91 | View in AlphaFoldDB ↗ |