DPCfam | MC406863
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 223 ± 37 aa |
| Residues in low-complexity regions (%) | 6.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.08 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF05910 |
| Sequences matching dominant architecture (%) | 92.37 |
| Average overlap percent | 83.83 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q9LEU1 | 52-273 | 222 | RTFLGGHSVNLFLHSQDYYNHSSPLSFSSADLSLSSAVSFHLNLNTLAFWKKRGSRFVSPKIQVFWDLSKAKFDSGSEPRSGFYI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6GF77-F1 | 32-260 | 99.12 | 88.99 | View in AlphaFoldDB ↗ |