DPCfam | MC40676
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 256 ± 54 aa |
| Residues in low-complexity regions (%) | 13.65 |
| Residues in coiled-coil regions (%) | 0.5 |
| Predicted disordered residues (%) | 68.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17095 |
| Sequences matching dominant architecture (%) | 97.37 |
| Average overlap percent | 20.55 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A194PML6 | 405-678 | 274 | FAGRRSRRSSISDDSQLTVENFGGSQDRLHFAGRNPEKELATVASVAAMTHQRKISAPAGPIDYNPPLRSSRQDIRGSIQFFHED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A1ZAU8-F1 | 419-660 | 96.44 | 40.23 | View in AlphaFoldDB ↗ |