DPCfam | MC406447
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 315 ± 52 aa |
| Residues in low-complexity regions (%) | 4.98 |
| Residues in coiled-coil regions (%) | 0.2 |
| Predicted disordered residues (%) | 20.7 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF12348 |
| Sequences matching dominant architecture (%) | 0.45 |
| Average overlap percent | 48.55 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A197JVZ8 | 1302-1569 | 268 | EAAMDYLVTQITSDDASQSIDALKQLEKALHGPLDAIIPHINDLVNAHTLQIRLAYTGLEQRNNSTTRVCKHLVNSLVSIFSNKQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q14008-F1 | 1546-1885 | 100.00 | 80.03 | View in AlphaFoldDB ↗ |