DPCfam | MC406243
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 338 ± 28 aa |
| Residues in low-complexity regions (%) | 16.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 54.77 |
| Average transmembrane regions | 1.24 |
| Dominant Pfam architecture(s) | PF00002 |
| Sequences matching dominant architecture (%) | 80.65 |
| Average overlap percent | 6.51 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3P425 | 2436-2789 | 354 | GLRTACGVLLLVTVTCLLAILSVNSDMIIFHYLFAGFNCLQGPFIFLFRIVFNKDARKAMRYCCSRKRPDHMIKSKPSSYNCNTS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9QYP2-F1 | 1786-2136 | 100.00 | 38.91 | View in AlphaFoldDB ↗ |