DPCfam | MC406202
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Residues in low-complexity regions (%) | 1.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00615 |
| Sequences matching dominant architecture (%) | 12.37 |
| Average overlap percent | 19.91 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B6JWG9 | 2-63 | 62 | SDQIPSLLDILTKPCERPLDLYNYYIYMIENENRVDYLDLWLDIMQHAIVCRQYVKSLRDST... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WIB7-F1 | 16-78 | 95.45 | 90.05 | View in AlphaFoldDB ↗ |