DPCfam | MC406038
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 303 ± 43 aa |
| Residues in low-complexity regions (%) | 1.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.72 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF07289 |
| Sequences matching dominant architecture (%) | 79.73 |
| Average overlap percent | 95.86 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S9W6M0 | 17-354 | 338 | DREVRVDSEANELRLRDNAEESYAAIREVEDSKVGYLGLLRVTNLRVIWICDQKKRMNLSIGYYCMTKVAVKEVESRLGTGKTEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9CZQ9-F1 | 10-338 | 100.00 | 88.92 | View in AlphaFoldDB ↗ |