DPCfam | MC405939
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 258 ± 40 aa |
| Residues in low-complexity regions (%) | 5.81 |
| Residues in coiled-coil regions (%) | 2.97 |
| Predicted disordered residues (%) | 5.2 |
| Average transmembrane regions | 5.46 |
| Dominant Pfam architecture(s) | PF06814 |
| Sequences matching dominant architecture (%) | 14.81 |
| Average overlap percent | 51.82 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J4J4C2 | 277-495 | 219 | LFITLLIASSGWCILHVPISWVRNIIGMIAVCVYWLPSLLMEFIDTTSSSRLLFLFSMMLLSLTALVFVIYGNMRDSQMHLNAHL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1KGK7-F1 | 30-320 | 100.00 | 77.21 | View in AlphaFoldDB ↗ |