DPCfam | MC405930
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 211 ± 24 aa |
| Residues in low-complexity regions (%) | 6.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.88 |
| Average transmembrane regions | 0.44 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A5K5T7 | 83-292 | 210 | LWGDSTNKLILQKFEKLLAEVRNSSKVQTTIKGMLKDLFQGAVQDEENKRATQEFFLNILQNSKSPLGSVFTDVLQTEHVRNSLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8IB08-F1 | 218-440 | 99.56 | 73.74 | View in AlphaFoldDB ↗ |