DPCfam | MC405836
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 83 ± 12 aa |
| Residues in low-complexity regions (%) | 5.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.63 |
| Average transmembrane regions | 1.54 |
| Dominant Pfam architecture(s) | PF03814 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 19.56 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M1U4V7 | 29-118 | 90 | TLAGTEQIIPQGPIASQEAIKSLGTNGGGFFNANSAHPYENPTVITNYIQMVSIFAIAAALTYTFGKWVGNTKQGWLIFGVMLVL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A4SZG9-F1 | 244-329 | 95.56 | 97.73 | View in AlphaFoldDB ↗ |