DPCfam | MC405579
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Residues in low-complexity regions (%) | 2.92 |
| Residues in coiled-coil regions (%) | 6.3 |
| Predicted disordered residues (%) | 34.93 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF02815- PF01365 |
| Sequences matching dominant architecture (%) | 89.66 |
| Average overlap percent | 27.53 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1P6C413 | 373-484 | 112 | KAVALKDGHMDDCFTFFMALEEESKSARVIRKCSSVLNRFLRGIEALQREGKQAQDWNRVDLSEVLKLMEDLIDYFAQPDEDDFE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0N4UI19-F1 | 386-495 | 100.00 | 92.10 | View in AlphaFoldDB ↗ |