DPCfam | MC404924
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 219 ± 37 aa |
| Residues in low-complexity regions (%) | 2.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.74 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A8J2U0 | 16-358 | 343 | SVPAPEYYNSFKYNILDFLRQYGQLVPLQLEPCSTRVWLVPLRHKTVSGPVKLHVYEEHIDEDSGAPPTCDQCRNMGWQHHPVSN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1JHU7-F1 | 36-250 | 99.55 | 93.21 | View in AlphaFoldDB ↗ |