DPCfam | MC404696
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Residues in low-complexity regions (%) | 1.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.17 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16219 |
| Sequences matching dominant architecture (%) | 88.89 |
| Average overlap percent | 92.54 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A8TCP4 | 59-193 | 134 | ELAPLGNATPKAAAEGISYFEIAGIESSKYPFEGVSPNQTSTIQDHGGAKLVVYVWQRGYGNVYDATMNGVSKRASSEYRCGYDL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O31994-F1 | 24-138 | 90.48 | 93.87 | View in AlphaFoldDB ↗ |