DPCfam | MC404405
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Residues in low-complexity regions (%) | 1.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 40.6 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q1YP03 | 26-98 | 73 | AEIITLPIGEQTRQSELQLPERGTHKNTVLENFGDPQEMTSAVGEPPISQWRYGEYVVYFEGNWVIQAVVKHP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4DP71-F1 | 28-72 | 60.81 | 44.13 | View in AlphaFoldDB ↗ |