DPCfam | MC403951
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 58 ± 4 aa |
| Residues in low-complexity regions (%) | 0.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.45 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04101 |
| Sequences matching dominant architecture (%) | 97.22 |
| Average overlap percent | 27.65 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B3RI21 | 106-165 | 60 | ENHQVEFATKLSNSGYLYCCTCNNLTTVLQESNFSKLKKFPSSEPESFCHFLNQQLGLPP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8BML3-F1 | 105-162 | 98.31 | 78.72 | View in AlphaFoldDB ↗ |