DPCfam | MC403647
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 156 ± 23 aa |
| Residues in low-complexity regions (%) | 1.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.13 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01351 |
| Sequences matching dominant architecture (%) | 1.79 |
| Average overlap percent | 29.34 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V6DAF9 | 156-314 | 159 | CVFENEFNRLVTASNNKSASLFDITCRLVMFLWEQFATQDLRVFVDRQGGRMHYLPALERVFEGSRFVILEENDLVSAYRIEYGP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9CWY8-F1 | 161-214 | 32.53 | 88.89 | View in AlphaFoldDB ↗ |