DPCfam | MC402990
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 431 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Residues in low-complexity regions (%) | 0.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.32 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11954 |
| Sequences matching dominant architecture (%) | 44.96 |
| Average overlap percent | 85.2 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009E62978 | 459-542 | 84 | IQVSPEILKRYIGVYEIRPGFNISVTFENGKLMTQATGRQKFQVYPESETKFFPKVFDAEIEFIENDSGNIDSFIIYKGGQKII... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P32959-F1 | 363-449 | 96.67 | 94.38 | View in AlphaFoldDB ↗ |