DPCfam | MC402887
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 225 ± 50 aa |
| Residues in low-complexity regions (%) | 4.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 40.31 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF17683- PF02270 |
| Sequences matching dominant architecture (%) | 71.26 |
| Average overlap percent | 93.35 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D2MHP5 | 56-232 | 177 | LDGIVSQKYDAVPAQTSTRAGQGGAAADEAYRALTRKRTLASLQKGRSVAVITDPKAATKLYQQQHHRTALYVKHTQASIGSGGG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q03123-F1 | 20-257 | 100.00 | 84.57 | View in AlphaFoldDB ↗ |