DPCfam | MC402764
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 68 ± 8 aa |
| Residues in low-complexity regions (%) | 2.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.65 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B3XU91 | 255-338 | 84 | RVHGTIFACHVTRPVVKIAEWIIHEASHNRLNTLMCARPHLFNDMKPIYTSPWRDELRPLYGIYHGCYVHCRVLHFYRLLEQNR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ENE6-F1 | 185-242 | 89.39 | 92.28 | View in AlphaFoldDB ↗ |