DPCfam | MC402710
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Residues in low-complexity regions (%) | 2.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.62 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF13401 |
| Sequences matching dominant architecture (%) | 3.51 |
| Average overlap percent | 24.17 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E5BVP0 | 2-62 | 61 | DIWHYPRTELATFILNGMDKGLLQRVSIFAPRKRGKTQFIKKDIIPMARELGVLPIYVDFW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1NE84-F1 | 22-71 | 72.06 | 85.53 | View in AlphaFoldDB ↗ |