DPCfam | MC40257
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 233 ± 27 aa |
| Residues in low-complexity regions (%) | 2.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.08 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF12473 |
| Sequences matching dominant architecture (%) | 95.74 |
| Average overlap percent | 32.44 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A9ZAU0 | 378-612 | 235 | SWDPPAGMEPHVPVLFLNLNADDLSAQNTNDEFSIAGLNSILSKEHGHKFYTLQILQHFDKDVCAVASWDSSMHDSPALNRVTEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8PX20-F1 | 1086-1313 | 99.57 | 77.06 | View in AlphaFoldDB ↗ |