DPCfam | MC402407
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 126 ± 15 aa |
| Residues in low-complexity regions (%) | 8.15 |
| Residues in coiled-coil regions (%) | 0.7 |
| Predicted disordered residues (%) | 1.0 |
| Average transmembrane regions | 3.25 |
| Dominant Pfam architecture(s) | PF16954 |
| Sequences matching dominant architecture (%) | 49.25 |
| Average overlap percent | 42.95 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W0X3P4 | 22-147 | 126 | LGISAGILVGIYFCSPGKENPHVIFWGFFSSLWALDAMVLHIFYMKGKLRNYVNKLKGWMYAGAFGQLLGVSSFIVYIVLGIVFH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q20106-F1 | 19-167 | 97.01 | 83.66 | View in AlphaFoldDB ↗ |