DPCfam | MC402377
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 215 ± 31 aa |
| Residues in low-complexity regions (%) | 16.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.29 |
| Average transmembrane regions | 3.59 |
| Dominant Pfam architecture(s) | PF16697 |
| Sequences matching dominant architecture (%) | 52.38 |
| Average overlap percent | 46.74 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K9VJD8 | 24-275 | 252 | VGNLITEPFMQRLPSESFVDSVLSTGRWFGLVGGGIATAIMFGYYYYIKGKPQIKQALKNGGLFGLIAGAISGAIAEGIYSGIGD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7APZ3-F1 | 48-146 | 42.54 | 86.63 | View in AlphaFoldDB ↗ |