DPCfam | MC401874
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 78 ± 10 aa |
| Residues in low-complexity regions (%) | 1.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.75 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01764 |
| Sequences matching dominant architecture (%) | 53.26 |
| Average overlap percent | 2.41 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1P8B5V6 | 83-174 | 92 | ESQFAGASIYSRKDFFAKVGLEIAHPYTKYKVTKFIYATSDIHVPESFLLFPISREGWSKESNWMGYVAVTDDQGTALLGRRDIV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7M1D9-F1 | 86-170 | 100.00 | 94.33 | View in AlphaFoldDB ↗ |