DPCfam | MC401844
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 161 ± 27 aa |
| Residues in low-complexity regions (%) | 9.06 |
| Residues in coiled-coil regions (%) | 0.28 |
| Predicted disordered residues (%) | 37.33 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X1N3H9 | 1-189 | 189 | MGWVHPDDTIGHEGDIVAVLESGEDAPKDTFDQAVQAMQDSRWGWERYDGHEDAPLAAGIRAICTCGWKGPRRRADFTDPDEASL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I6Y9Z5-F1 | 22-77 | 30.25 | 96.52 | View in AlphaFoldDB ↗ |