DPCfam | MC40177
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 283 ± 30 aa |
| Residues in low-complexity regions (%) | 5.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.86 |
| Average transmembrane regions | 0.97 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A178EN53 | 490-752 | 263 | ITNIAAKCGILYGAPRRNDSSASVLFDPGSSWTLSMYTCMSTAKTVIKTVKFRFNGTDDDLSSLEVMELKDKEYPNEESKPLWGV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2FFC0-F1 | 488-787 | 97.64 | 84.06 | View in AlphaFoldDB ↗ |