DPCfam | MC401624
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Residues in low-complexity regions (%) | 7.46 |
| Residues in coiled-coil regions (%) | 0.49 |
| Predicted disordered residues (%) | 6.19 |
| Average transmembrane regions | 0.55 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M5NSR1 | 10-76 | 67 | MSLASKLILAFVGVTLVVLSATLLLARWSFERGFLEYVDAVQQSRLEQVAQELAERFQQDGGWQQVD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GSM3-F1 | 7-83 | 97.47 | 82.07 | View in AlphaFoldDB ↗ |