DPCfam | MC401022
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 115 ± 14 aa |
| Residues in low-complexity regions (%) | 2.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.98 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14701 |
| Sequences matching dominant architecture (%) | 96.34 |
| Average overlap percent | 5.48 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D2NEH4 | 629-749 | 121 | HVAEYFLDVARNAKPDLYVVAELFTNSDWKDNIFVNRLGITSLIRELNDKHKQVQVNQLFCVISNPEAMSAWDSHEEGRLVFRYG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CDG5-F1 | 565-685 | 99.09 | 80.30 | View in AlphaFoldDB ↗ |